PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008233726.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WOX
Protein Properties Length: 180aa    MW: 20542 Da    PI: 9.6417
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008233726.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.47.8e-213091157
                    TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                    ++ R+++t+eq+++L +lF++  r+ps++++++++++l    +++ ++V++WFqN++a+e++
  XP_008233726.1 30 KCGRWNPTTEQVKVLTDLFRSgLRTPSTDQIQKISSQLsfygKIESKNVFYWFQNHKARERQ 91
                    568*****************99**************************************97 PP

2Wus_type_Homeobox114.65e-373093265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++ RW+Pt+eQ+k+L++l++sGlrtP++++iq+i+++L+ yGkie+kNVfyWFQN+kaRerqk+
     XP_008233726.1 30 KCGRWNPTTEQVKVLTDLFRSGLRTPSTDQIQKISSQLSFYGKIESKNVFYWFQNHKARERQKR 93
                       678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.0462792IPR001356Homeobox domain
SMARTSM003893.9E-42996IPR001356Homeobox domain
PfamPF000467.4E-183191IPR001356Homeobox domain
SuperFamilySSF466898.55E-123294IPR009057Homeodomain-like
CDDcd000862.66E-43393No hitNo description
Gene3DG3DSA:1.10.10.602.2E-83391IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010078Biological Processmaintenance of root meristem identity
GO:1902459Biological Processpositive regulation of stem cell population maintenance
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MDEGMSGFCI KAASFRGSGG GAGNGNNGTK CGRWNPTTEQ VKVLTDLFRS GLRTPSTDQI  60
QKISSQLSFY GKIESKNVFY WFQNHKARER QKRRKVSIDD KDFTRRDQDK ISSPKQLNQV  120
SEPARVIETL QLFPVNSYDD SEAEKTRFHA NEYFKEATAF AYRVGTEMDH PPLDLRLSFL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6991162e-76KJ699116.1 Rosa canina WUSCHEL-related homeobox protein (WOX1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008233726.11e-134PREDICTED: WUSCHEL-related homeobox 7
SwissprotQ8H1D22e-66WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLM5XSQ71e-119M5XSQ7_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s19950.11e-83(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60143452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.14e-63WUSCHEL related homeobox 5